PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1350s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 169aa    MW: 18860.4 Da    PI: 8.8935
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1350s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.6e-393997260
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                            +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k 
  SapurV1A.1350s0040.1.p 39 PEKIIQCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKTKP 97
                            68999***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-283896IPR003851Zinc finger, Dof-type
PfamPF027013.9E-324196IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.094397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MAGQEEGIKL FGATITMHGR GVVSEEEQTK ENPTVDKRPE KIIQCPRCKS METKFCYFNN  60
YNVNQPRHFC KGCQRYWTAG GALRNVPVGA GRRKTKPPSR GALGGYPEEC LFDCSGGIHQ  120
LELDGVLLEE WHLATTQGSF RQVFPLKRRR SGGSGDQDPF HQKAVIQF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00166DAPTransfer from AT1G29160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0066931e-43AP006693.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT35C17, TM0399, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008472.12e-91PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotP683503e-59DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLB9I1M05e-90B9I1M0_POPTR; Uncharacterized protein
STRINGPOPTR_0011s07400.11e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64833251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.12e-60Dof family protein